Rv3583c
- Type
- protein_coding
- Name
- Rv3583c
- Locus Name
-
Rv3583c
- Product
-
Possible transcription factor
- Functional Category
-
Regulatory proteins
- Location
- 4025056..4025544 (- strand)
- Gene Length
- 488 bp
- Nucleotides
-
ATGATTTTCAAGGTCGGAGACACCGTTGTCTATCCACACCACGGTGCTGCGTTAGTCGAGGCGATCGAAACCCGGACCATCAAAGGGGAACAAAAAGAGTATCTCGTCTTGAAAGTTGCGCAGGGCGACCTGACAGTACGAGTTCCCGCTGAAAACGCCGAATACGTCGGTGTTCGCGATGTCGTCGGGCAGGAAGGCCTGGACAAGGTTTTCCAGGTGTTGCGTGCCCCGCACACCGAGGAGCCGACGAACTGGTCACGTCGTTACAAGGCGAACCTCGAGAAACTCGCATCCGGCGATGTGAACAAGGTGGCCGAGGTAGTGCGCGATTTGTGGCGTCGCGACCAGGAGCGTGGCTTGTCGGCCGGTGAGAAGCGCATGCTGGCCAAGGCCCGGCAGATTCTGGTCGGCGAGTTGGCGTTGGCTGAGAGCACCGATGACGCCAAAGCCGAGACCATCCTTGACGAGGTTTTAGCCGCCGCGTCTTG
- Drug Resistance
- Mutations
- Function
- Controls rRNA transcription by binding to the RNA polymerase (RNAP). Required for replication and persistence during infection of mice. {ECO:0000269|PubMed:19596241, ECO:0000269|PubMed:22904282}.
- Family
-
CarD family
- GO
-
- pathogenesis GO:0009405 biological_process
- stringent response GO:0015968 biological_process
- regulation of growth rate GO:0040009 biological_process
- InterPro
4ILU
- Name
- RNA polymerase-binding transcription factor CarD
- Family
- CarD family
- Protein Sequence
-
MIFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS
- Mass
- 17,907 Da
- Length
- 162 Aa
Summary
Rv3583c doesn't seem to be a targeted by any drug.
Rv3583c doesn't seem to be involved in any pathway.
- Interaction of CarD with RNA polymerase mediates Mycobacterium tuberculosis viability, rifampin resistance, and pathogenesis.
- J Bacteriol. 2012 Oct;194(20):5621-31. doi: 10.1128/JB.00879-12. Epub 2012 Aug 17.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- CarD is an essential regulator of rRNA transcription required for Mycobacterium tuberculosis persistence.
- Cell. 2009 Jul 10;138(1):146-59. doi: 10.1016/j.cell.2009.04.041.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.