mhuD
- Type
- protein_coding
- Name
- mhuD
- Locus Name
-
Rv3592
- Product
-
Possible heme degrading protein MhuD
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 4034057..4034374 (+ strand)
- Gene Length
- 317 bp
- Nucleotides
-
TGCCAGTGGTGAAGATCAACGCAATCGAGGTGCCCGCCGGCGCTGGCCCCGAGCTGGAGAAGCGGTTCGCTCACCGCGCGCACGCGGTCGAGAACTCCCCGGGTTTCCTCGGCTTTCAGCTGTTACGTCCGGTCAAGGGTGAAGAACGCTACTTCGTGGTGACACACTGGGAGTCCGATGAAGCATTCCAGGCGTGGGCAAACGGGCCCGCCATCGCAGCCCATGCCGGACACCGGGCCAACCCCGTGGCGACCGGTGCTTCGCTGCTGGAATTCGAGGTCGTGCTTGACGTCGGTGGGACCGGCAAGACTGCATAA
- Drug Resistance
- Mutations
- Function
- Catalyzes the oxidative degradation of the heme macrocyclic porphyrin ring in the presence of a suitable electron donor such as ascorbate or NADPH--cytochrome P450 reductase, with subsequent release of free iron. {ECO:0000269|PubMed:19917297, ECO:0000269|PubMed:23420845}.
- Family
-
Antibiotic biosynthesis monooxygenase family
- GO
-
- metal ion binding GO:0046872 molecular_function
- heme binding GO:0020037 molecular_function
- cell wall GO:0005618 cellular_component
- plasma membrane GO:0005886 cellular_component
- heme catabolic process GO:0042167 biological_process
- monooxygenase activity GO:0004497 molecular_function
- heme oxygenase (decyclizing) activity GO:0004392 molecular_function
- InterPro
3HX9
- Name
- Heme oxygenase (mycobilin-producing) (EC 1.14.99.57) (Mycobacterial heme utilization, degrader) (MHUD)
- Family
- Antibiotic biosynthesis monooxygenase family
- Protein Sequence
-
MPVVKINAIEVPAGAGPELEKRFAHRAHAVENSPGFLGFQLLRPVKGEERYFVVTHWESDEAFQAWANGPAIAAHAGHRANPVATGASLLEFEVVLDVGGTGKTA
- Mass
- 11,185 Da
- Length
- 105 Aa
Summary
Rv3592 doesn't seem to be a targeted by any drug.
Rv3592 doesn't seem to be involved in any pathway.
- Crystallographic and spectroscopic insights into heme degradation by Mycobacterium tuberculosis MhuD.
- Inorg Chem. 2014 Jun 16;53(12):5931-40. doi: 10.1021/ic500033b. Epub 2014 Jun 5.
- Unusual diheme conformation of the heme-degrading protein from Mycobacterium tuberculosis.
- J Mol Biol. 2010 Jan 22;395(3):595-608. doi: 10.1016/j.jmb.2009.11.025. Epub 2009 Nov 14.
- A new way to degrade heme: the Mycobacterium tuberculosis enzyme MhuD catalyzes heme degradation without generating CO.
- J Biol Chem. 2013 Apr 5;288(14):10101-9. doi: 10.1074/jbc.M112.448399. Epub 2013 Feb 18.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.