lsr2
- Type
- protein_coding
- Name
- lsr2
- Locus Name
-
Rv3597c
- Product
-
Iron-regulated H-NS-like protein Lsr2
- Functional Category
-
Information pathways
- Location
- 4040981..4041319 (- strand)
- Gene Length
- 338 bp
- Nucleotides
-
ATGGCGAAGAAAGTAACCGTCACCTTGGTCGACGATTTCGACGGTTCGGGCGCCGCCGACGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTATGAGATCGACCTTTCCACTAAGAATGCCACGAAACTGCGTGGCGACCTGAAGCAATGGGTGGCGGCGGGCCGTCGCGTCGGTGGGCGCCGGCGCGGCCGTTCCGGATCCGGCCGTGGACGTGGCGCGATCGACCGCGAGCAGAGCGCGGCGATCCGCGAATGGGCTCGTCGTAACGGGCACAATGTGTCGACGCGAGGCCGGATCCCGGCCGACGTCATCGACGCATACCACGCGGCGACCTG
- Drug Resistance
- Mutations
- Function
- DNA-bridging protein that has both architectural and regulatory roles (PubMed:18187505). Influences the organization of chromatin and gene expression by binding non-specifically to DNA, with a preference for AT-rich sequences, and bridging distant DNA segments (PubMed:20133735). Binds in the minor groove of AT-rich DNA (PubMed:21673140). Represses expression of multiple genes involved in a broad range of cellular processes, including major virulence factors or antibiotic-induced genes, such as iniBAC or efpA (PubMed:17590082), and genes important for adaptation of changing O(2) levels (PubMed:24895305). May also activate expression of some gene (PubMed:24895305). May coordinate global gene regulation and virulence (PubMed:20133735). Also protects mycobacteria against reactive oxygen intermediates during macrophage infection by acting as a physical barrier to DNA degradation (PubMed:19237572); the physical protection has been questioned (PubMed:24895305). A strain overexpressing this protein consumes O(2) more slowly than wild-type (PubMed:24895305). {ECO:0000269|PubMed:17590082, ECO:0000269|PubMed:18187505, ECO:0000269|PubMed:19237572, ECO:0000269|PubMed:20133735, ECO:0000269|PubMed:21673140, ECO:0000269|PubMed:24895305}.
- Family
-
Lsr2 family
- GO
-
- cellular response to oxygen levels GO:0071453 biological_process
- pathogenesis GO:0009405 biological_process
- response to iron ion GO:0010039 biological_process
- nucleoid GO:0009295 cellular_component
- DNA protection GO:0042262 biological_process
- cell wall GO:0005618 cellular_component
- response to hydrogen peroxide GO:0042542 biological_process
- cytosol GO:0005829 cellular_component
- DNA binding GO:0003677 molecular_function
- regulation of transcription, DNA-templated GO:0006355 biological_process
- plasma membrane GO:0005886 cellular_component
- InterPro
2KNG
- Name
- Nucleoid-associated protein Lsr2
- Family
- Lsr2 family
- Protein Sequence
-
MAKKVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRVGGRRRGRSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAAT
- Mass
- 12,098 Da
- Length
- 112 Aa
Summary
Rv3597c doesn't seem to be a targeted by any drug.
Rv3597c doesn't seem to be involved in any pathway.
- The structure of the oligomerization domain of Lsr2 from Mycobacterium tuberculosis reveals a mechanism for chromosome organization and protection.
- PLoS One. 2012;7(6):e38542. doi: 10.1371/journal.pone.0038542. Epub 2012 Jun 13.
- Lsr2 is a nucleoid-associated protein that targets AT-rich sequences and virulence genes in Mycobacterium tuberculosis.
- Proc Natl Acad Sci U S A. 2010 Mar 16;107(11):5154-9. doi: 10.1073/pnas.0913551107. Epub 2010 Jan 20.
- Mycobacterium tuberculosis Lsr2 is a global transcriptional regulator required for adaptation to changing oxygen levels and virulence.
- MBio. 2014 Jun 3;5(3):e01106-14. doi: 10.1128/mBio.01106-14.
- Structural basis for recognition of AT-rich DNA by unrelated xenogeneic silencing proteins.
- Proc Natl Acad Sci U S A. 2011 Jun 28;108(26):10690-5. doi: 10.1073/pnas.1102544108. Epub 2011 Jun 14.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- The multifunctional histone-like protein Lsr2 protects mycobacteria against reactive oxygen intermediates.
- Proc Natl Acad Sci U S A. 2009 Mar 17;106(11):4414-8. doi: 10.1073/pnas.0810126106. Epub 2009 Feb 23.
- Lsr2 of Mycobacterium tuberculosis is a DNA-bridging protein.
- Nucleic Acids Res. 2008 Apr;36(7):2123-35. doi: 10.1093/nar/gkm1162. Epub 2008 Jan 10.
- Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis.
- PLoS Pathog. 2007 Jun;3(6):e87. doi: 10.1371/journal.ppat.0030087.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.