Gene - combatTB X

panC

Type: protein_coding
Name: panC
Locus Name: Rv3602c
Product: Pantoate--beta-alanine ligase PanC (pantothenate synthetase) (pantoate activating enzyme)
Functional Category: Intermediary metabolism and respiration
Location: 4044281..4045210 (- strand)
Gene Length: 929 bp
Nucleotides: ATGACGATTCCTGCGTTCCATCCCGGTGAACTCAATGTGTACTCGGCACCGGGGGATGTCGCCGATGTCAGTCGCGCACTGCGACTCACCGGCCGGCGAGTGATGTTGGTGCCTACTATGGGTGCGCTGCACGAAGGCCACCTCGCGTTGGTGCGTGCGGCCAAGCGGGTGCCCGGATCGGTCGTCGTCGTGTCGATCTTCGTCAACCCGATGCAATTCGGTGCCGGGGAAGATCTCGACGCCTATCCCCGCACCCCGGACGACGACCTGGCGCAACTGCGGGCCGAAGGCGTGGAAATCGCTTTCACGCCAACTACCGCGGCGATGTATCCCGACGGCCTGCGCACCACCGTGCAACCCGGTCCGTTGGCCGCCGAACTCGAGGGCGGCCCGCGGCCAACCCATTTCGCCGGCGTGCTGACGGTCGTGCTAAAGCTGCTGCAGATCGTGCGCCCGGATCGGGTGTTCTTCGGTGAGAAGGACTACCAGCAGCTGGTGCTGATCCGGCAGCTGGTCGCGGACTTCAACCTCGATGTCGCGGTGGTCGGCGTGCCGACCGTGCGCGAAGCCGACGGGCTGGCGATGTCGTCGCGCAACCGCTACCTGGACCCGGCCCAGCGTGCGGCGGCCGTCGCGCTCTCGGCGGCGCTAACGGCCGCAGCGCATGCGGCAACGGCTGGCGCGCAGGCCGCGCTGGATGCCGCCCGTGCGGTGCTCGACGCTGCACCCGGCGTGGCGGTCGACTACCTGGAGCTGCGCGATATCGGGCTTGGCCCGATGCCGCTCAACGGTTCCGGTCGGCTGCTGGTTGCTGCCCGGCTTGGCACCACCAGGCTGCTGGACAACATTGCGATTGAAATCGGAACTTTCGCCGGCACCGACCGCCCGGACGGATACCGGGCAATCCTCGAATCACATTGGAGAAACTG
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Catalyzes the condensation of pantoate with beta-alanine in an ATP-dependent reaction via a pantoyl-adenylate intermediate. {ECO:0000269|PubMed:11669627}.

Family

Pantothenate synthetase family

GO

pantoate-beta-alanine ligase activity GO:0004592 molecular_function
pantothenate biosynthetic process from valine GO:0033317 biological_process
cytosol GO:0005829 cellular_component
ATP binding GO:0005524 molecular_function
manganese ion binding GO:0030145 molecular_function
pantothenate biosynthetic process GO:0015940 biological_process
magnesium ion binding GO:0000287 molecular_function
pathogenesis GO:0009405 biological_process
beta-alanine metabolic process GO:0019482 biological_process

InterPro

UniProt: P9WIL5
GenBank: Rv3602c
EnsemblBacteria: Rv3602c
Mycobrowser: Rv3602c

PDB IDs:

Summary

Name: Pantothenate synthetase (PS) (EC 6.3.2.1) (Pantoate--beta-alanine ligase) (Pantoate-activating enzyme)
Family: Pantothenate synthetase family
Protein Sequence: MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN
Mass: 32,678 Da
Length: 309 Aa

Rv3602c doesn't seem to be a targeted by any drug.

beta-Alanine metabolism mtu00410
mtu00410
PATHWAY_MAP mtu00410 beta-Alanine metabolism

Pantothenate and CoA biosynthesis mtu00770
mtu00770
PATHWAY_MAP mtu00770 Pantothenate and CoA biosynthesis

Crystal structure of the pantothenate synthetase from Mycobacterium tuberculosis, snapshots of the enzyme in action.: Biochemistry. 2006 Feb 14;45(6):1554-61. doi: 10.1021/bi051873e.
Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate.: Protein Sci. 2003 May;12(5):1097-108. doi: 10.1110/ps.0241803.
Pantothenate and pantetheine antagonize the antitubercular activity of pyrazinamide.: Antimicrob Agents Chemother. 2014 Dec;58(12):7258-63. doi: 10.1128/AAC.04028-14. Epub 2014 Sep 22.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
Steady-state and pre-steady-state kinetic analysis of Mycobacterium tuberculosis pantothenate synthetase.: Biochemistry. 2001 Oct 30;40(43):12904-12. doi: 10.1021/bi011522+.
A pantothenate auxotroph of Mycobacterium tuberculosis is highly attenuated and protects mice against tuberculosis.: Nat Med. 2002 Oct;8(10):1171-4. doi: 10.1038/nm765. Epub 2002 Sep 9.
Active site residues in Mycobacterium tuberculosis pantothenate synthetase required in the formation and stabilization of the adenylate intermediate.: Biochemistry. 2004 Jun 8;43(22):7171-8. doi: 10.1021/bi049676n.
targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.: BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.