folB
- Type
- protein_coding
- Name
- folB
- Locus Name
-
Rv3607c
- Product
-
Probable dihydroneopterin aldolase FolB (DHNA)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 4048744..4049145 (- strand)
- Gene Length
- 401 bp
- Nucleotides
-
ATGGCTGACCGAATCGAACTGCGCGGCCTGACCGTGCATGGTCGGCACGGGGTCTACGACCACGAGCGAGTGGCCGGGCAGCGGTTTGTCATCGATGTCACCGTGTGGATAGACCTGGCCGAGGCCGCCAACAGCGACGACTTGGCCGACACCTATGACTACGTGCGGCTGGCTTCGCGGGCGGCCGAGATCGTCGCCGGACCCCCGCGGAAGCTGATCGAAACGGTCGGGGCCGAGATCGCTGATCACGTGATGGACGACCAGCGAGTGCATGCCGTTGAGGTGGCGGTACACAAGCCGCAGGCGCCCATTCCGCAGACGTTCGACGATGTGGCGGTGGTGATCCGACGCTCACGGCGCGGCGGCCGCGGTTGGGTAGTCCCGGCGGGCGGCGCGGTATG
- Drug Resistance
- Mutations
- Function
- Catalyzes the conversion of 7,8-dihydroneopterin to 6-hydroxymethyl-7,8-dihydropterin, 7,8-dihydromonapterin and 7,8-dihydroxanthopterin, respectively, in equal quantities. After longer incubation times the only product is 6-hydroxymethyl-7,8-dihydropterin. {ECO:0000269|PubMed:23150985}.
- Family
-
DHNA family
- GO
-
- tetrahydrofolate biosynthetic process GO:0046654 biological_process
- folic acid biosynthetic process GO:0046656 biological_process
- isomerase activity GO:0016853 molecular_function
- oxidoreductase activity GO:0016491 molecular_function
- dihydroneopterin aldolase activity GO:0004150 molecular_function
- folic acid-containing compound metabolic process GO:0006760 biological_process
- InterPro
1NBU
- Name
- Dihydroneopterin aldolase (DHNA) (EC 4.1.2.25) (7,8-dihydroneopterin 2'-epimerase) (7,8-dihydroneopterin aldolase) (7,8-dihydroneopterin epimerase) (EC 5.1.99.8) (7,8-dihydroneopterin hydroxylase) (EC 1.13.11.81) (Dihydroneopterin epimerase) (Dihydroneopterin hydroxylase)
- Family
- DHNA family
- Protein Sequence
-
MADRIELRGLTVHGRHGVYDHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASRAAEIVAGPPRKLIETVGAEIADHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSRRGGRGWVVPAGGAV
- Mass
- 14,552 Da
- Length
- 133 Aa
Summary
Rv3607c doesn't seem to be a targeted by any drug.
-
-
Folate biosynthesis mtu00790
mtu00790PATHWAY_MAP mtu00790 Folate biosynthesis
-
- Regulation by oligomerization in a mycobacterial folate biosynthetic enzyme.
- J Mol Biol. 2005 May 27;349(1):61-72. doi: 10.1016/j.jmb.2005.03.023. Epub 2005 Apr 2.
- One substrate, five products: reactions catalyzed by the dihydroneopterin aldolase from Mycobacterium tuberculosis.
- J Am Chem Soc. 2012 Dec 5;134(48):19758-71. doi: 10.1021/ja308350f. Epub 2012 Nov 26.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.