espD
- Type
- protein_coding
- Name
- espD
- Locus Name
-
Rv3614c
- Product
-
ESX-1 secretion-associated protein EspD
- Functional Category
-
Cell wall and cell processes
- Location
- 4054142..4054696 (- strand)
- Gene Length
- 554 bp
- Nucleotides
-
GTGGACTTGCCCGGAAATGACTTTGACAGCAACGATTTCGACGCCGTGGATCTCTGGGGTGCCGACGGCGCGGAGGGCTGGACTGCGGATCCGATTATTGGCGTCGGGTCGGCGGCGACCCCGGACACCGGACCCGACCTGGACAATGCCCACGGTCAGGCGGAGACGGACACCGAACAAGAGATCGCGCTTTTTACCGTGACGAATCCCCCACGCACGGTGTCGGTATCGACGCTGATGGACGGCCGGATTGACCATGTCGAGCTGTCGGCCAGGGTGGCCTGGATGAGTGAGTCGCAGCTCGCTTCTGAGATCCTGGTGATTGCCGACCTGGCGCGGCAGAAGGCGCAGTCGGCCCAGTACGCCTTCATCCTTGACAGGATGAGTCAACAGGTCGATGCAGATGAACACCGCGTCGCACTGCTACGTAAGACCGTGGGCGAAACCTGGGGGTTACCATCGCCGGAAGAAGCCGCGGCAGCAGAAGCTGAGGTGTTCGCGACGCGCTACAGCGACGATTGTCCAGCACCAGACGACGAGAGCGATCCATGGTG
- Drug Resistance
- Mutations
- Function
- Required for ESX-1 function (PubMed:16135231, PubMed:22155774). Required for the maintenance of adequate cellular levels of both EspA and EspC (PubMed:22155774). Facilitates EsxA secretion (PubMed:22155774). {ECO:0000269|PubMed:16135231, ECO:0000269|PubMed:22155774}.
- Family
-
Unknown
- GO
-
- protein secretion by the type VII secretion system GO:0044315 biological_process
- pathogenesis GO:0009405 biological_process
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
-
- Unknown
Summary
- Name
- ESX-1 secretion-associated protein EspD
- Family
- Unknown
- Protein Sequence
-
MDLPGNDFDSNDFDAVDLWGADGAEGWTADPIIGVGSAATPDTGPDLDNAHGQAETDTEQEIALFTVTNPPRTVSVSTLMDGRIDHVELSARVAWMSESQLASEILVIADLARQKAQSAQYAFILDRMSQQVDADEHRVALLRKTVGETWGLPSPEEAAAAEAEVFATRYSDDCPAPDDESDPW
- Mass
- 19,835 Da
- Length
- 184 Aa
Rv3614c doesn't seem to be a targeted by any drug.
Rv3614c doesn't seem to be involved in any pathway.
- EspR, a regulator of the ESX-1 secretion system in Mycobacterium tuberculosis, is directly regulated by the two-component systems MprAB and PhoPR.
- Microbiology. 2015 Mar;161(Pt 3):477-89. doi: 10.1099/mic.0.000023. Epub 2014 Dec 23.
- MprAB regulates the espA operon in Mycobacterium tuberculosis and modulates ESX-1 function and host cytokine response.
- J Bacteriol. 2013 Jan;195(1):66-75. doi: 10.1128/JB.01067-12. Epub 2012 Oct 26.
- Long-range transcriptional control of an operon necessary for virulence-critical ESX-1 secretion in Mycobacterium tuberculosis.
- J Bacteriol. 2012 May;194(9):2307-20. doi: 10.1128/JB.00142-12. Epub 2012 Mar 2.
- EspD is critical for the virulence-mediating ESX-1 secretion system in Mycobacterium tuberculosis.
- J Bacteriol. 2012 Feb;194(4):884-93. doi: 10.1128/JB.06417-11. Epub 2011 Dec 9.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Secreted transcription factor controls Mycobacterium tuberculosis virulence.
- Nature. 2008 Aug 7;454(7205):717-21. doi: 10.1038/nature07219.
- The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis.
- Mol Microbiol. 2006 Apr;60(2):312-30. doi: 10.1111/j.1365-2958.2006.05102.x.
- A non-RD1 gene cluster is required for Snm secretion in Mycobacterium tuberculosis.
- Mol Microbiol. 2005 Sep;57(6):1653-63. doi: 10.1111/j.1365-2958.2005.04800.x.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.