espC
- Type
- protein_coding
- Name
- espC
- Locus Name
-
Rv3615c
- Product
-
ESX-1 secretion-associated protein EspC
- Functional Category
-
Cell wall and cell processes
- Location
- 4054812..4055123 (- strand)
- Gene Length
- 311 bp
- Nucleotides
-
ATGACGGAAAACTTGACCGTCCAGCCCGAGCGTCTCGGTGTACTGGCGTCGCACCATGACAACGCGGCGGTCGATGCCTCCTCGGGCGTCGAAGCTGCCGCTGGCCTAGGCGAATCTGTGGCGATCACTCACGGTCCGTACTGCTCACAGTTCAACGACACGTTAAATGTGTACTTGACTGCCCACAATGCCCTGGGCTCGTCCTTGCATACGGCCGGTGTCGATCTCGCCAAAAGTCTTCGAATTGCGGCGAAGATATATAGCGAGGCCGACGAAGCGTGGCGCAAGGCTATCGACGGGTTGTTTACCTG
- Drug Resistance
- Mutations
- Function
- Required for ESX-1 function. Required for either stability or expression of EspA. {ECO:0000269|PubMed:16135231, ECO:0000269|PubMed:19682254}.
- Family
-
EspC family
- GO
-
- protein secretion by the type VII secretion system GO:0044315 biological_process
- pathogenesis GO:0009405 biological_process
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- active evasion of host immune response GO:0042783 biological_process
- InterPro
Summary
- Name
- ESX-1 secretion-associated protein EspC
- Family
- EspC family
- Protein Sequence
-
MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT
- Mass
- 10,795 Da
- Length
- 103 Aa
Rv3615c doesn't seem to be a targeted by any drug.
Rv3615c doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis Differentially Activates cGAS- and Inflammasome-Dependent Intracellular Immune Responses through ESX-1.
- Cell Host Microbe. 2015 Jun 10;17(6):799-810. doi: 10.1016/j.chom.2015.05.003. Epub 2015 Jun 2.
- EspR, a regulator of the ESX-1 secretion system in Mycobacterium tuberculosis, is directly regulated by the two-component systems MprAB and PhoPR.
- Microbiology. 2015 Mar;161(Pt 3):477-89. doi: 10.1099/mic.0.000023. Epub 2014 Dec 23.
- A novel vaccine p846 encoding Rv3615c, Mtb10.4, and Rv2660c elicits robust immune response and alleviates lung injury induced by Mycobacterium infection.
- Hum Vaccin Immunother. 2014;10(2):378-90. doi: 10.4161/hv.27121. Epub 2013 Nov 26.
- MprAB regulates the espA operon in Mycobacterium tuberculosis and modulates ESX-1 function and host cytokine response.
- J Bacteriol. 2013 Jan;195(1):66-75. doi: 10.1128/JB.01067-12. Epub 2012 Oct 26.
- Long-range transcriptional control of an operon necessary for virulence-critical ESX-1 secretion in Mycobacterium tuberculosis.
- J Bacteriol. 2012 May;194(9):2307-20. doi: 10.1128/JB.00142-12. Epub 2012 Mar 2.
- Rv3615c is a highly immunodominant RD1 (Region of Difference 1)-dependent secreted antigen specific for Mycobacterium tuberculosis infection.
- Proc Natl Acad Sci U S A. 2011 Apr 5;108(14):5730-5. doi: 10.1073/pnas.1015153108. Epub 2011 Mar 22.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- ESX-1 secreted virulence factors are recognized by multiple cytosolic AAA ATPases in pathogenic mycobacteria.
- Mol Microbiol. 2009 Sep;73(5):950-62. doi: 10.1111/j.1365-2958.2009.06821.x. Epub 2009 Aug 4.
- Secreted transcription factor controls Mycobacterium tuberculosis virulence.
- Nature. 2008 Aug 7;454(7205):717-21. doi: 10.1038/nature07219.
- The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis.
- Mol Microbiol. 2006 Apr;60(2):312-30. doi: 10.1111/j.1365-2958.2006.05102.x.
- A non-RD1 gene cluster is required for Snm secretion in Mycobacterium tuberculosis.
- Mol Microbiol. 2005 Sep;57(6):1653-63. doi: 10.1111/j.1365-2958.2005.04800.x.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.