esxV
- Type
- protein_coding
- Name
- esxV
- Locus Name
-
Rv3619c
- Product
-
Putative ESAT-6 like protein EsxV (ESAT-6 like protein 1)
- Functional Category
-
Cell wall and cell processes
- Location
- 4059984..4060268 (- strand)
- Gene Length
- 284 bp
- Nucleotides
-
ATGACCATCAACTATCAATTCGGGGACGTCGACGCTCACGGCGCCATGATCCGCGCTCAGGCCGGGTCGCTGGAGGCCGAGCATCAGGCCATCATTTCTGATGTGTTGACCGCGAGTGACTTTTGGGGCGGCGCCGGTTCGGCGGCCTGCCAGGGGTTCATTACCCAGCTGGGCCGTAACTTCCAGGTGATCTACGAGCAGGCCAACGCCCACGGGCAGAAGGTGCAGGCTGCCGGCAACAACATGGCACAAACCGACAGCGCCGTCGGCTCCAGCTGGGCCTA
- Drug Resistance
- Mutations
- Function
- Probable virulence factor. In mice, elicits increased levels of IFN-gamma, IL-12 and IgG(2a), indicating a dominant Th1 host immune response. {ECO:0000269|PubMed:21134129}.
- Family
-
WXG100 family, ESAT-6 subfamily
- GO
-
- pathogenesis GO:0009405 biological_process
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- InterPro
Summary
- Name
- ESAT-6-like protein EsxV (Antigen Mtb9.9B)
- Family
- WXG100 family, ESAT-6 subfamily
- Protein Sequence
-
MTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
- Mass
- 9,833 Da
- Length
- 94 Aa
Rv3619c doesn't seem to be a targeted by any drug.
Rv3619c doesn't seem to be involved in any pathway.
- Molecular characterization of secretory proteins Rv3619c and Rv3620c from Mycobacterium tuberculosis H37Rv.
- FEBS J. 2011 Jan;278(2):341-53. doi: 10.1111/j.1742-4658.2010.07958.x. Epub 2010 Dec 6.
- Systematic genetic nomenclature for type VII secretion systems.
- PLoS Pathog. 2009 Oct;5(10):e1000507. doi: 10.1371/journal.ppat.1000507. Epub 2009 Oct 30.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- Expression cloning of an immunodominant family of Mycobacterium tuberculosis antigens using human CD4(+) T cells.
- J Exp Med. 2000 Feb 7;191(3):551-60. doi: 10.1084/jem.191.3.551.