Rv3654c
- Type
- protein_coding
- Name
- Rv3654c
- Locus Name
-
Rv3654c
- Product
-
Conserved hypothetical protein
- Functional Category
-
Conserved hypotheticals
- Location
- 4094660..4094914 (- strand)
- Gene Length
- 254 bp
- Nucleotides
-
GTGGTGGCTCGTCACCGCGCACAGGCGGCGGCTGATCTGGCTTCGTTAGCCGCTGCCGCCCGGCTGCCGTCCGGACTGGCGGCGGCCTGCGCGCGTGCGACGCTGGTGGCCCGTGCGATGCGCGTCGAGCACGCGCAGTGCAGGGTGGTGGACCTCGACGTGGTCGTCACCGTCGAGGTGGCTGTCGCGTTCGCGGGTGTGGCGACCGCCACCGCGCGGGCGGGGCCGGCCAAGGTGCCCACGACACCGGGTTG
- Drug Resistance
- Mutations
- Function
- Effector protein that participates in the suppression of macrophage apoptosis by blocking the extrinsic pathway. Recognizes the host polypyrimidine tract binding protein-associated splicing factor (PSF), which probably leads to its cleavage, diminishing the level of caspase-8 in macrophages. {ECO:0000269|PubMed:20454556}.
- Family
-
Unknown
- GO
-
- pathogenesis GO:0009405 biological_process
- host cell cytoplasm GO:0030430 cellular_component
- negative regulation by symbiont of host apoptotic process GO:0033668 biological_process
- extracellular region GO:0005576 cellular_component
- InterPro
Summary
- Name
- Apoptosis inhibitor Rv3654c
- Family
- Unknown
- Protein Sequence
-
MVARHRAQAAADLASLAAAARLPSGLAAACARATLVARAMRVEHAQCRVVDLDVVVTVEVAVAFAGVATATARAGPAKVPTTPG
- Mass
- 8,359 Da
- Length
- 84 Aa
Rv3654c doesn't seem to be a targeted by any drug.
Rv3654c doesn't seem to be involved in any pathway.
- Secreted Mycobacterium tuberculosis Rv3654c and Rv3655c proteins participate in the suppression of macrophage apoptosis.
- PLoS One. 2010 May 4;5(5):e10474. doi: 10.1371/journal.pone.0010474.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.