Gene - combatTB X

crp

Type: protein_coding
Name: crp
Locus Name: Rv3676
Product: Transcriptional regulatory protein Crp (Crp/Fnr-family)
Functional Category: Regulatory proteins
Location: 4116478..4117152 (+ strand)
Gene Length: 674 bp
Nucleotides: TGGACGAGATCCTGGCCAGGGCAGGAATCTTCCAAGGCGTGGAGCCCAGCGCAATCGCCGCACTGACGAAACAGCTGCAGCCCGTCGACTTCCCCCGTGGACACACGGTCTTCGCGGAAGGGGAGCCGGGCGATCGGCTGTACATCATCATCTCGGGGAAGGTCAAGATCGGTCGCCGGGCACCAGACGGCCGAGAAAACCTGTTAACCATCATGGGCCCGTCGGACATGTTCGGCGAGTTGTCGATCTTCGACCCGGGTCCGCGCACGTCCAGCGCGACCACGATCACCGAGGTGCGGGCGGTGTCGATGGACCGCGACGCGCTGCGGTCATGGATCGCCGATCGTCCCGAAATCTCCGAACAGCTGCTGCGGGTGCTGGCCCGCCGGCTGCGCCGCACCAACAACAACCTGGCCGACCTCATCTTCACCGATGTGCCCGGTCGGGTGGCCAAGCAGCTGTTGCAGCTCGCCCAGCGTTTCGGCACCCAGGAAGGTGGCGCATTGCGGGTCACCCACGACCTGACACAGGAAGAAATCGCCCAGCTGGTCGGGGCCTCACGCGAGACGGTGAACAAGGCACTGGCTGATTTCGCTCACCGCGGCTGGATCCGCCTTGAGGGCAAGAGTGTGCTGATCTCTGACTCCGAAAGACTGGCCCGCCGAGCGAGGTAA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Global transcriptional regulator that complexes with cAMP and binds to specific DNA promoter sites, causing DNA-bending, to regulate transcription. cAMP improves binding to specific DNA sequences, probably by altering protein conformation. The CRP regulon is predicted to contain about 115 genes. Some genes are activated by CRP (rpfA, whiB1) while others are repressed (fadD10). There are 2 CRP-binding sites in the promoter of whiB1, at low concentrations of CRP with or without cAMP transcription of whiB1 is enhanced via site CRP1, then repressed as site CRP2 is filled. {ECO:0000269|PubMed:15882420, ECO:0000269|PubMed:20028978}.

Family

Unknown

GO

plasma membrane GO:0005886 cellular_component
regulation of transcription, DNA-templated GO:0006355 biological_process
negative regulation of transcription, DNA-templated GO:0045892 biological_process
positive regulation of transcription, DNA-templated GO:0045893 biological_process
DNA binding GO:0003677 molecular_function
cytosol GO:0005829 cellular_component
cAMP binding GO:0030552 molecular_function
cell wall GO:0005618 cellular_component
DNA-binding transcription factor activity GO:0003700 molecular_function
pathogenesis GO:0009405 biological_process

InterPro

UniProt: P9WMH3
GenBank: Rv3676
EnsemblBacteria: Rv3676
Mycobrowser: Rv3676

PDB IDs:

Summary

Name: CRP-like cAMP-activated global transcriptional regulator (cAMP receptor protein) (CRP) (cAMP regulatory protein)
Family: Unknown
Protein Sequence: MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Mass: 24,791 Da
Length: 224 Aa

Rv3676 doesn't seem to be a targeted by any drug.

Two-component system mtu02020
mtu02020
Environmental Information Processing; Signal transduction

Quorum sensing mtu02024
mtu02024
Cellular Processes; Cellular community - prokaryotes

Solution NMR evidence for symmetry in functionally or crystallographically asymmetric homodimers.: J Am Chem Soc. 2011 Dec 14;133(49):19578-81. doi: 10.1021/ja206967d. Epub 2011 Nov 14.
Mapping conformational transitions in cyclic AMP receptor protein: crystal structure and normal-mode analysis of Mycobacterium tuberculosis apo-cAMP receptor protein.: Biophys J. 2010 Jan 20;98(2):305-14. doi: 10.1016/j.bpj.2009.10.016.
Structural insights into the mechanism of the allosteric transitions of Mycobacterium tuberculosis cAMP receptor protein.: J Biol Chem. 2009 Dec 25;284(52):36581-91. doi: 10.1074/jbc.M109.041343. Epub 2009 Sep 9.
Profound asymmetry in the structure of the cAMP-free cAMP Receptor Protein (CRP) from Mycobacterium tuberculosis.: J Biol Chem. 2009 Mar 27;284(13):8228-32. doi: 10.1074/jbc.C800215200. Epub 2009 Feb 4.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties.: J Biol Chem. 2010 Mar 5;285(10):7016-27. doi: 10.1074/jbc.M109.047720. Epub 2009 Dec 22.
A member of the cAMP receptor protein family of transcription regulators in Mycobacterium tuberculosis is required for virulence in mice and controls transcription of the rpfA gene coding for a resuscitation promoting factor.: Mol Microbiol. 2005 Jun;56(5):1274-86. doi: 10.1111/j.1365-2958.2005.04609.x.
Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein.: J Bacteriol. 2005 Nov;187(22):7795-804. doi: 10.1128/JB.187.22.7795-7804.2005.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.