whiB4
- Type
- protein_coding
- Name
- whiB4
- Locus Name
-
Rv3681c
- Product
-
Probable transcriptional regulatory protein WhiB-like WhiB4
- Functional Category
-
Regulatory proteins
- Location
- 4121198..4121554 (- strand)
- Gene Length
- 356 bp
- Nucleotides
-
GTGTCAGGAACCCGTCCAGCCGCTCGAAGGACTAACCTCACGGCTGCACAGAACGTGGTACGCAGCGTAGACGCGGAAGAGCGGATCGCGTGGGTATCCAAGGCGCTGTGCCGGACTACCGACCCTGACGAACTCTTTGTTCGAGGAGCCGCACAACGCAAGGCCGCGGTGATCTGCCGTCACTGTCCGGTAATGCAAGAGTGTGCGGCAGATGCGCTGGACAACAAGGTCGAGTTCGGTGTTTGGGGTGGCATGACCGAGCGCCAGCGCAGGGCTCTGCTCAAGCAACATCCCGAGGTGGTTTCGTGGTCGGACTACCTTGAGAAGCGCAAGCGCCGCACCGGCACCGCCGGATA
- Drug Resistance
- Mutations
- Function
- Redox-responsive transcriptional regulator that regulates a set of genes involved in protection against environmental stresses encountered during infection. The loss of the O(2) and NO-responsive 4Fe-4S cluster and subsequent redox modifications of Cys residue thiols (possibly by disulfide bond formation) may activate its role in gene regulation. The thiol-oxidized apo-form binds in a sequence non-specific manner to GC-rich DNA, probably in the minor groove. Represses transcription of a number of genes including itself. The reduced apo-form and holo-form do not bind DNA. The apo-form can act as protein disulfide reductase. {ECO:0000269|PubMed:17302817, ECO:0000269|PubMed:19016840, ECO:0000269|PubMed:22780904}.
- Family
-
WhiB family
- GO
-
- metal ion binding GO:0046872 molecular_function
- protein disulfide oxidoreductase activity GO:0015035 molecular_function
- cell wall GO:0005618 cellular_component
- DNA binding GO:0003677 molecular_function
- negative regulation of transcription, DNA-templated GO:0045892 biological_process
- cytoplasm GO:0005737 cellular_component
- protein-disulfide reductase activity GO:0047134 molecular_function
- 4 iron, 4 sulfur cluster binding GO:0051539 molecular_function
- dinitrosyl-iron complex binding GO:0035731 molecular_function
- cell redox homeostasis GO:0045454 biological_process
- InterPro
Summary
- Name
- Transcriptional regulator WhiB4
- Family
- WhiB family
- Protein Sequence
-
MSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGAAQRKAAVICRHCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEVVSWSDYLEKRKRRTGTAG
- Mass
- 13,211 Da
- Length
- 118 Aa
Rv3681c doesn't seem to be a targeted by any drug.
Rv3681c doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis WhiB4 regulates oxidative stress response to modulate survival and dissemination in vivo.
- Mol Microbiol. 2012 Sep;85(6):1148-65. doi: 10.1111/j.1365-2958.2012.08165.x. Epub 2012 Jul 26.
- Studies on structural and functional divergence among seven WhiB proteins of Mycobacterium tuberculosis H37Rv.
- FEBS J. 2009 Jan;276(1):76-93. doi: 10.1111/j.1742-4658.2008.06755.x.
- Molecular function of WhiB4/Rv3681c of Mycobacterium tuberculosis H37Rv: a [4Fe-4S] cluster co-ordinating protein disulphide reductase.
- Mol Microbiol. 2007 Mar;63(5):1414-31. doi: 10.1111/j.1365-2958.2007.05589.x.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.