Rv3752c
- Type
- protein_coding
- Name
- Rv3752c
- Locus Name
-
Rv3752c
- Product
-
Possible cytidine/deoxycytidylate deaminase
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 4199247..4199705 (- strand)
- Gene Length
- 458 bp
- Nucleotides
-
GTGACCACTGACGAAGATCTGATCCGTGCGGCGTTGGCGGTCGCGGCGACGGCGGGTCCGCGCGACGTGCCGGTGGGCGCGGTGGTCGTCGGCGCCGACGGAACCGAACTCGCCCGGGCGGTGAATGCCCGCGAGGCGCTCGGCGATCCCACCGCGCACGCGGAAATCCTGGCGATGCGGTTGGCGGCCGGTGTGCTCGGCGACGGGTGGCGGCTGGAGGGGACCACCTTGGCGGTCACCGTCGAACCGTGCACTATGTGTGCCGGTGCCCTGGTGCTGGCCCGCGTCGCGCGGCTGGTCTTCGGTGCCTGGGAGCCCAAGACCGGGGCGGTCGGCTCGTTGTGGGACGTGGTCCGTGATCGTCGGCTCAATCACCGCCCGGAGGTACGCGGCGGTGTGCTCGCGCGGGAGTGCGCCGCGCCGCTGGAGGCCTTCTTCGCCCGCCAGCGATTGGGGTG
- Drug Resistance
- Mutations
- Function
- Catalyzes the deamination of adenosine to inosine at the wobble position 34 of tRNA(Arg2). {ECO:0000256|HAMAP-Rule:MF_00972}.
- Family
-
Cytidine and deoxycytidylate deaminase family
- GO
-
- tRNA-specific adenosine-34 deaminase complex GO:0052718 cellular_component
- tRNA-specific adenosine-34 deaminase activity GO:0052717 molecular_function
- zinc ion binding GO:0008270 molecular_function
- tRNA wobble adenosine to inosine editing GO:0002100 biological_process
- InterPro
Summary
- Name
- tRNA-specific adenosine deaminase (EC 3.5.4.33)
- Family
- Cytidine and deoxycytidylate deaminase family
- Protein Sequence
-
MTTDEDLIRAALAVAATAGPRDVPVGAVVVGADGTELARAVNAREALGDPTAHAEILAMRLAAGVLGDGWRLEGTTLAVTVEPCTMCAGALVLARVARLVFGAWEPKTGAVGSLWDVVRDRRLNHRPEVRGGVLARECAAPLEAFFARQRLG
- Mass
- 15,877 Da
- Length
- 152 Aa
Rv3752c doesn't seem to be a targeted by any drug.
Rv3752c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.