proW
- Type
- protein_coding
- Name
- proW
- Locus Name
-
Rv3757c
- Product
-
Possible osmoprotectant (glycine betaine/carnitine/choline/L-proline) transport integral membrane protein ABC transporter ProW
- Functional Category
-
None
- Location
- 4202610..4203299 (- strand)
- Gene Length
- 689 bp
- Nucleotides
-
ATGCACTACCTGATGACCCACCCGGGAGCGGCCTGGGCGCTGACCGTCGTCCATCTGCGCCTCTCGTTGCTGCCGGTGCTGATCGGGCTGATGAGCGCGGTGCCGTTGGGCCTGCTGGTGCAGCGCGCGCCGCTGCTTCGCCGGCTGACGACGGCGACCGCCAGCGTTATATTCACCATCCCGTCGCTAGCGCTATTCGTGGTGTTGCCGCTGATCATCGGAACCCGGATCCTCGACGAGGCCAATGTCATTGTGGCGTTGGCGGCCTACACCACGGCCCTGCTGGTGCGGGCGGTGCTCGAAGCGCTGGACGCGGTGCCGGCGCAGGTGCATGACGCGGCCACCGCCATCGGCTATTCGCGGATCGCTCAGATGTTGAAAGTCGAACTGCCGCTGTCTATCCCCGTGCTGGTAGCCGGGCTGCGGGTGGTCGCGGTTACCAACATCGCGATGGTGTCCGTGGGTTCGGTGATAGGAATCGGGGGCCTGGGAACCTGGTTCACCGCGGGGTATCAGACCAACAAGAGTGACCAGATCGTTGCCGGCGTCGTAGCGATGTTCCTGCTGGCGATTGTCGTCGACGTGGTGATCAACCTCGCCGGTCGGCTGGCCACGCCATGGGAACGGGCGCCGCGGGCAGCCCGTCGGCGCCGCCAGGTCGCGGCCCCGATCACGGGCGGAGCGCGATG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Binding-protein-dependent transport system permease family
- GO
-
- transmembrane transport GO:0055085 biological_process
- plasma membrane GO:0005886 cellular_component
- response to host GO:0075136 biological_process
- glycine betaine transport GO:0031460 biological_process
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- Possible osmoprotectant (Glycine betaine/carnitine/choline/L-proline) transport integral membrane protein ABC transporter ProW
- Family
- Binding-protein-dependent transport system permease family
- Protein Sequence
-
MHYLMTHPGAAWALTVVHLRLSLLPVLIGLMSAVPLGLLVQRAPLLRRLTTATASVIFTIPSLALFVVLPLIIGTRILDEANVIVALAAYTTALLVRAVLEALDAVPAQVHDAATAIGYSRIAQMLKVELPLSIPVLVAGLRVVAVTNIAMVSVGSVIGIGGLGTWFTAGYQTNKSDQIVAGVVAMFLLAIVVDVVINLAGRLATPWERAPRAARRRRQVAAPITGGAR
- Mass
- 24,109 Da
- Length
- 229 Aa
Rv3757c doesn't seem to be a targeted by any drug.
-
-
ABC transporters mtu02010
mtu02010Environmental Information Processing; Membrane transport
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.