lpqH



Type
protein_coding
Name
lpqH
Locus Name

Rv3763

Product

19 kDa lipoprotein antigen precursor LpqH

Functional Category

None

Location
4209047..4209526 (+ strand)
Gene Length
479 bp
Nucleotides
TGAAGCGTGGACTGACGGTCGCGGTAGCCGGAGCCGCCATTCTGGTCGCAGGTCTTTCCGGATGTTCAAGCAACAAGTCGACTACAGGAAGCGGTGAGACCACGACCGCGGCAGGCACGACGGCAAGCCCCGGCGCCGCCTCCGGGCCGAAGGTCGTCATCGACGGTAAGGACCAGAACGTCACCGGCTCCGTGGTGTGCACAACCGCGGCCGGCAATGTCAACATCGCGATCGGCGGGGCGGCGACCGGCATTGCCGCCGTGCTCACCGACGGCAACCCTCCGGAGGTGAAGTCCGTTGGGCTCGGTAACGTCAACGGCGTCACGCTGGGATACACGTCGGGCACCGGACAGGGTAACGCCTCGGCAACCAAGGACGGCAGCCACTACAAGATCACTGGGACCGCTACCGGGGTCGACATGGCCAACCCGATGTCACCGGTGAACAAGTCGTTCGAAATCGAGGTGACCTGTTCCTAA
Drug Resistance

Check for drug resistance association at TBDREAMDB

Mutations

Check for mutants available at TARGET


Function
Based on its structure might be involved in ligand transport (Ref.25) (By similarity). {ECO:0000250|UniProtKB:P65307, ECO:0000305|Ref.25}.; FUNCTION: A host TLR2 agonist (PubMed:10426995, PubMed:11441098, PubMed:12874328). Plays a complicated role in bacterial interactions with the host immune system; some effects favor the host (induces interleukin 1-beta and IL-12 p40 (IL12B), both increase the host's immune response) while others favor the bacteria (increases growth in monocyte-derived macrophages and decreases host MHC class II (MHC-II) expression and antigen processing) (PubMed:16177361). Induces host (human and mouse) IL-12 p40 (IL12B, a proinflammatory cytokine) release by monocyte cell lines via TLR2 and CD14 (PubMed:10426995). Induces host (human) monocytes to produce TNF-alpha, IL-6 and IL-12 p40; LpqH is a more potent inducer than PstS1 (PubMed:16622205). Inhibits MHC-II expression and antigen processing in host (mouse) macrophages via TLR2 (independently of TLR4) probably via the lipid modification (PubMed:11441098). Stimulates host (human) dendritic cell maturation to become MHC-II-positive antigen presenting cells via TLR2, which depends on lipidation; nonlipidated protein does not stimulate maturation (PubMed:11160304). Inhibits host (human and mouse) IFN-gamma signaling in macrophages via TLR2; decreases IFN-gamma stimulated MHC-II antigen processing as well as decreasing IFN-gamma-mediated up-regulation of immunoglobulin gamma Fc receptor (FCGR1A), enabling the bacteria to evade the immune system (PubMed:12874328). In resting human CD4+ T-cells lipidated (but probably not nonlipidated protein) is a costimulatory ligand (with anti-CD3 and anti-CD28) for T-cell proliferation and IFN-gamma and IL-2 production (PubMed:21078852). Human CD4+ T-cells probably use TLR1/TLR2 heterodimers to respond to mycobacterial lipoproteins (PubMed:21078852). Acting via TLR2 enhances expression of host peroxisome proliferator-activated receptor gamma (PPARG), a regulator of inflammation and immunoregulation, and increases p38 MAPK phosphorylation, IL-6 and TNF-alpha expression (PubMed:25504154). Native or nonlipidated recombinant protein missing the first 4 residues have been shown to induce apoptosis in the human macrophage cell line THP-1 and human monocyte-derived macrophages in a TLR2, caspase-3 and caspase-8-dependent manner (PubMed:12594264). Protein overexpressed in M.smegmatis (lipidated and probably glycosylated) induces apoptosis in human macrophages via TLR2 in a caspase-3/caspase-8-mediated manner, but also in a caspase-independent manner where mitochondrial apoptosis-inducing factor (AIFM1) translocates to the nucleus (PubMed:23316255). Another study found mature, native (lipidated) protein did not induce apoptosis in THP-1 macrophage cell line (PubMed:12874328). Functions as an adhesin, binds to human and mouse macrophages (PubMed:25359607). {ECO:0000269|PubMed:10426995, ECO:0000269|PubMed:11160304, ECO:0000269|PubMed:11441098, ECO:0000269|PubMed:12594264, ECO:0000269|PubMed:12874328, ECO:0000269|PubMed:16177361, ECO:0000269|PubMed:16622205, ECO:0000269|PubMed:21078852, ECO:0000269|PubMed:23316255, ECO:0000269|PubMed:25359607, ECO:0000269|PubMed:25504154}.
Family

Mycobacterial 19 kDa antigen family

GO
InterPro

UniProt
P9WK61
GenBank
Rv3763
EnsemblBacteria
Rv3763
Mycobrowser
Rv3763


4ZJM
Summary
Name
Lipoprotein LpqH (19 kDa lipoprotein antigen) (Putative transporter LpqH) (p19)
Family
Mycobacterial 19 kDa antigen family
Protein Sequence
MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS
Mass
15,147 Da
Length
159 Aa

Rv3763 doesn't seem to be a targeted by any drug.


  • Tuberculosis

    Tuberculosis mtu05152

    mtu05152

    Human Diseases; Infectious disease: bacterial


Regulation of antigen presentation by Mycobacterium tuberculosis: a role for Toll-like receptors.
Nat Rev Microbiol. 2010 Apr;8(4):296-307. doi: 10.1038/nrmicro2321.
Mycobacterium tuberculosis 19-kDa lipoprotein induces Toll-like receptor 2-dependent peroxisome proliferator-activated receptor gamma expression and promotes inflammatory responses in human macrophages.
Mol Med Rep. 2015 Apr;11(4):2921-6. doi: 10.3892/mmr.2014.3070. Epub 2014 Dec 10.
PstS-1, the 38-kDa Mycobacterium tuberculosis glycoprotein, is an adhesin, which binds the macrophage mannose receptor and promotes phagocytosis.
Scand J Immunol. 2015 Jan;81(1):46-55. doi: 10.1111/sji.12249.
Specific interaction between Mycobacterium tuberculosis lipoprotein-derived peptides and target cells inhibits mycobacterial entry in vitro.
Chem Biol Drug Des. 2014 Dec;84(6):626-41. doi: 10.1111/cbdd.12365. Epub 2014 Jul 10.
Lipoproteins of slow-growing Mycobacteria carry three fatty acids and are N-acylated by apolipoprotein N-acyltransferase BCG_2070c.
BMC Microbiol. 2013 Oct 5;13:223. doi: 10.1186/1471-2180-13-223.
The 19 kDa Mycobacterium tuberculosis lipoprotein (LpqH) induces macrophage apoptosis through extrinsic and intrinsic pathways: a role for the mitochondrial apoptosis-inducing factor.
Clin Dev Immunol. 2012;2012:950503. doi: 10.1155/2012/950503. Epub 2012 Dec 19.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Mycobacteria release active membrane vesicles that modulate immune responses in a TLR2-dependent manner in mice.
J Clin Invest. 2011 Apr;121(4):1471-83. doi: 10.1172/JCI44261.
Mycobacterium tuberculosis lipoproteins directly regulate human memory CD4(+) T cell activation via Toll-like receptors 1 and 2.
Infect Immun. 2011 Feb;79(2):663-73. doi: 10.1128/IAI.00806-10. Epub 2010 Nov 15.
A mutant of Mycobacterium tuberculosis lacking the 19-kDa lipoprotein Rv3763 is highly attenuated in vivo but retains potent vaccinogenic properties.
Vaccine. 2007 Oct 10;25(41):7153-9. doi: 10.1016/j.vaccine.2007.07.042. Epub 2007 Aug 13.
The mycobacterial 38-kilodalton glycolipoprotein antigen activates the mitogen-activated protein kinase pathway and release of proinflammatory cytokines through Toll-like receptors 2 and 4 in human monocytes.
Infect Immun. 2006 May;74(5):2686-96. doi: 10.1128/IAI.74.5.2686-2696.2006.
Effect of deletion or overexpression of the 19-kilodalton lipoprotein Rv3763 on the innate response to Mycobacterium tuberculosis.
Infect Immun. 2005 Oct;73(10):6831-7. doi: 10.1128/IAI.73.10.6831-6837.2005.
The 19-kDa antigen of Mycobacterium tuberculosis is a major adhesin that binds the mannose receptor of THP-1 monocytic cells and promotes phagocytosis of mycobacteria.
Microb Pathog. 2005 Sep;39(3):97-107. doi: 10.1016/j.micpath.2005.06.002.
The Mycobacterium tuberculosis 19-kilodalton lipoprotein inhibits gamma interferon-regulated HLA-DR and Fc gamma R1 on human macrophages through Toll-like receptor 2.
Infect Immun. 2003 Aug;71(8):4487-97. doi: 10.1128/iai.71.8.4487-4497.2003.
The 19-kDa Mycobacterium tuberculosis protein induces macrophage apoptosis through Toll-like receptor-2.
J Immunol. 2003 Mar 1;170(5):2409-16. doi: 10.4049/jimmunol.170.5.2409.
Toll-like receptor 2-dependent inhibition of macrophage class II MHC expression and antigen processing by 19-kDa lipoprotein of Mycobacterium tuberculosis.
J Immunol. 2001 Jul 15;167(2):910-8. doi: 10.4049/jimmunol.167.2.910.
Microbial lipopeptides stimulate dendritic cell maturation via Toll-like receptor 2.
J Immunol. 2001 Feb 15;166(4):2444-50. doi: 10.4049/jimmunol.166.4.2444.
Lipoprotein access to MHC class I presentation during infection of murine macrophages with live mycobacteria.
J Immunol. 2001 Jan 1;166(1):447-57. doi: 10.4049/jimmunol.166.1.447.
Host defense mechanisms triggered by microbial lipoproteins through toll-like receptors.
Science. 1999 Jul 30;285(5428):732-6. doi: 10.1126/science.285.5428.732.
Bacterial glycoproteins: a link between glycosylation and proteolytic cleavage of a 19 kDa antigen from Mycobacterium tuberculosis.
EMBO J. 1996 Jul 15;15(14):3547-54.
Lipoprotein antigens of Mycobacterium tuberculosis.
Res Microbiol. 1991 Jan;142(1):55-65.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
Stress proteins are immune targets in leprosy and tuberculosis.
Proc Natl Acad Sci U S A. 1988 Jun;85(12):4267-70. doi: 10.1073/pnas.85.12.4267.
Nucleotide sequence of the 19 kDa antigen gene from Mycobacterium tuberculosis.
Nucleic Acids Res. 1989 Feb 11;17(3):1249. doi: 10.1093/nar/17.3.1249.