- Type
- protein_coding
- Name
- lpqH
- Locus Name
-
Rv3763
- Product
-
19 kDa lipoprotein antigen precursor LpqH
- Functional Category
-
None
- Location
-
4209047..4209526
(+ strand)
- Gene Length
-
479
bp
- Nucleotides
-
TGAAGCGTGGACTGACGGTCGCGGTAGCCGGAGCCGCCATTCTGGTCGCAGGTCTTTCCGGATGTTCAAGCAACAAGTCGACTACAGGAAGCGGTGAGACCACGACCGCGGCAGGCACGACGGCAAGCCCCGGCGCCGCCTCCGGGCCGAAGGTCGTCATCGACGGTAAGGACCAGAACGTCACCGGCTCCGTGGTGTGCACAACCGCGGCCGGCAATGTCAACATCGCGATCGGCGGGGCGGCGACCGGCATTGCCGCCGTGCTCACCGACGGCAACCCTCCGGAGGTGAAGTCCGTTGGGCTCGGTAACGTCAACGGCGTCACGCTGGGATACACGTCGGGCACCGGACAGGGTAACGCCTCGGCAACCAAGGACGGCAGCCACTACAAGATCACTGGGACCGCTACCGGGGTCGACATGGCCAACCCGATGTCACCGGTGAACAAGTCGTTCGAAATCGAGGTGACCTGTTCCTAA
- Drug Resistance
-
Check for drug resistance
association at TBDREAMDB
- Mutations
-
Check for mutants available at
TARGET
- Function
- Based on its structure might be involved in ligand transport (Ref.25) (By similarity). {ECO:0000250|UniProtKB:P65307, ECO:0000305|Ref.25}.; FUNCTION: A host TLR2 agonist (PubMed:10426995, PubMed:11441098, PubMed:12874328). Plays a complicated role in bacterial interactions with the host immune system; some effects favor the host (induces interleukin 1-beta and IL-12 p40 (IL12B), both increase the host's immune response) while others favor the bacteria (increases growth in monocyte-derived macrophages and decreases host MHC class II (MHC-II) expression and antigen processing) (PubMed:16177361). Induces host (human and mouse) IL-12 p40 (IL12B, a proinflammatory cytokine) release by monocyte cell lines via TLR2 and CD14 (PubMed:10426995). Induces host (human) monocytes to produce TNF-alpha, IL-6 and IL-12 p40; LpqH is a more potent inducer than PstS1 (PubMed:16622205). Inhibits MHC-II expression and antigen processing in host (mouse) macrophages via TLR2 (independently of TLR4) probably via the lipid modification (PubMed:11441098). Stimulates host (human) dendritic cell maturation to become MHC-II-positive antigen presenting cells via TLR2, which depends on lipidation; nonlipidated protein does not stimulate maturation (PubMed:11160304). Inhibits host (human and mouse) IFN-gamma signaling in macrophages via TLR2; decreases IFN-gamma stimulated MHC-II antigen processing as well as decreasing IFN-gamma-mediated up-regulation of immunoglobulin gamma Fc receptor (FCGR1A), enabling the bacteria to evade the immune system (PubMed:12874328). In resting human CD4+ T-cells lipidated (but probably not nonlipidated protein) is a costimulatory ligand (with anti-CD3 and anti-CD28) for T-cell proliferation and IFN-gamma and IL-2 production (PubMed:21078852). Human CD4+ T-cells probably use TLR1/TLR2 heterodimers to respond to mycobacterial lipoproteins (PubMed:21078852). Acting via TLR2 enhances expression of host peroxisome proliferator-activated receptor gamma (PPARG), a regulator of inflammation and immunoregulation, and increases p38 MAPK phosphorylation, IL-6 and TNF-alpha expression (PubMed:25504154). Native or nonlipidated recombinant protein missing the first 4 residues have been shown to induce apoptosis in the human macrophage cell line THP-1 and human monocyte-derived macrophages in a TLR2, caspase-3 and caspase-8-dependent manner (PubMed:12594264). Protein overexpressed in M.smegmatis (lipidated and probably glycosylated) induces apoptosis in human macrophages via TLR2 in a caspase-3/caspase-8-mediated manner, but also in a caspase-independent manner where mitochondrial apoptosis-inducing factor (AIFM1) translocates to the nucleus (PubMed:23316255). Another study found mature, native (lipidated) protein did not induce apoptosis in THP-1 macrophage cell line (PubMed:12874328). Functions as an adhesin, binds to human and mouse macrophages (PubMed:25359607). {ECO:0000269|PubMed:10426995, ECO:0000269|PubMed:11160304, ECO:0000269|PubMed:11441098, ECO:0000269|PubMed:12594264, ECO:0000269|PubMed:12874328, ECO:0000269|PubMed:16177361, ECO:0000269|PubMed:16622205, ECO:0000269|PubMed:21078852, ECO:0000269|PubMed:23316255, ECO:0000269|PubMed:25359607, ECO:0000269|PubMed:25504154}.
- Family
-
Mycobacterial 19 kDa antigen family
- GO
-
- InterPro
-
4ZJM
-
- Name
-
Lipoprotein LpqH (19 kDa lipoprotein antigen) (Putative transporter LpqH) (p19)
- Family
-
Mycobacterial 19 kDa antigen family
- Protein
Sequence
-
MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS
-
Mass
-
15,147
Da
-
Length
-
159
Aa
Rv3763 doesn't seem to be a targeted by any
drug.
-
-
Tuberculosis
mtu05152
mtu05152
Human Diseases; Infectious disease: bacterial