Rv3789
- Type
- protein_coding
- Name
- Rv3789
- Locus Name
-
Rv3789
- Product
-
GTRA family protein
- Functional Category
-
None
- Location
- 4235374..4235739 (+ strand)
- Gene Length
- 365 bp
- Nucleotides
-
TGCGGTTCGTTGTCACCGGCGGCCTCGCTGGGATAGTTGACTTTGGCCTCTACGTCGTGCTGTACAAGGTGGCGGGCCTACAGGTCGACCTGTCCAAGGCCATCAGCTTCATCGTCGGCACCATCACCGCGTACCTGATCAACCGCCGGTGGACATTCCAGGCCGAGCCCAGCACGGCCCGATTCGTCGCGGTCATGCTCCTCTACGGAATCACCTTCGCCGTGCAGGTCGGACTCAACCACCTCTGCCTCGCACTCTTGCACTACCGGGCGTGGGCCATCCCCGTCGCGTTTGTGATCGCGCAGGGCACCGCCACGGTAATCAACTTCATCGTGCAGCGAGCCGTGATCTTCCGGATCCGCTGA
- Drug Resistance
- Mutations
- Function
- Required for arabinosylation of arabinogalactan (AG), an essential component of the mycobacterial cell wall. Probably acts as an anchor protein recruiting AftA, the first arabinosyl transferase involved in AG biosynthesis. {ECO:0000269|PubMed:26369580}.
- Family
-
GtrA family
- GO
-
- cell wall organization GO:0071555 biological_process
- plasma membrane GO:0005886 cellular_component
- capsule polysaccharide biosynthetic process GO:0045227 biological_process
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- Arabinogalactan biosynthesis recruiting protein Rv3789
- Family
- GtrA family
- Protein Sequence
-
MRFVVTGGLAGIVDFGLYVVLYKVAGLQVDLSKAISFIVGTITAYLINRRWTFQAEPSTARFVAVMLLYGITFAVQVGLNHLCLALLHYRAWAIPVAFVIAQGTATVINFIVQRAVIFRIR
- Mass
- 13,377 Da
- Length
- 121 Aa
Rv3789 doesn't seem to be a targeted by any drug.
Rv3789 doesn't seem to be involved in any pathway.
- GtrA Protein Rv3789 Is Required for Arabinosylation of Arabinogalactan in Mycobacterium tuberculosis.
- J Bacteriol. 2015 Dec;197(23):3686-97. doi: 10.1128/JB.00628-15. Epub 2015 Sep 14.
- DprE1 Is a Vulnerable Tuberculosis Drug Target Due to Its Cell Wall Localization.
- ACS Chem Biol. 2015 Jul 17;10(7):1631-6. doi: 10.1021/acschembio.5b00237. Epub 2015 Apr 29.
- A small multidrug resistance-like transporter involved in the arabinosylation of arabinogalactan and lipoarabinomannan in mycobacteria.
- J Biol Chem. 2012 Nov 16;287(47):39933-41. doi: 10.1074/jbc.M112.400986. Epub 2012 Oct 4.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.