Gene - combatTB X

fbpA

Type: protein_coding
Name: fbpA
Locus Name: Rv3804c
Product: Secreted antigen 85-a FbpA (mycolyl transferase 85A) (fibronectin-binding protein A) (antigen 85 complex A)
Functional Category: None
Location: 4265642..4266658 (- strand)
Gene Length: 1016 bp
Nucleotides: ATGCAGCTTGTTGACAGGGTTCGTGGCGCCGTCACGGGTATGTCGCGTCGACTCGTGGTCGGGGCCGTCGGCGCGGCCCTAGTGTCGGGTCTGGTCGGCGCCGTCGGTGGCACGGCGACCGCGGGGGCATTTTCCCGGCCGGGCTTGCCGGTGGAGTACCTGCAGGTGCCGTCGCCGTCGATGGGCCGTGACATCAAGGTCCAATTCCAAAGTGGTGGTGCCAACTCGCCCGCCCTGTACCTGCTCGACGGCCTGCGCGCGCAGGACGACTTCAGCGGCTGGGACATCAACACCCCGGCGTTCGAGTGGTACGACCAGTCGGGCCTGTCGGTGGTCATGCCGGTGGGTGGCCAGTCAAGCTTCTACTCCGACTGGTACCAGCCCGCCTGCGGCAAGGCCGGTTGCCAGACTTACAAGTGGGAGACCTTCCTGACCAGCGAGCTGCCGGGGTGGCTGCAGGCCAACAGGCACGTCAAGCCCACCGGAAGCGCCGTCGTCGGTCTTTCGATGGCTGCTTCTTCGGCGCTGACGCTGGCGATCTATCACCCCCAGCAGTTCGTCTACGCGGGAGCGATGTCGGGCCTGTTGGACCCCTCCCAGGCGATGGGTCCCACCCTGATCGGCCTGGCGATGGGTGACGCTGGCGGCTACAAGGCCTCCGACATGTGGGGCCCGAAGGAGGACCCGGCGTGGCAGCGCAACGACCCGCTGTTGAACGTCGGGAAGCTGATCGCCAACAACACCCGCGTCTGGGTGTACTGCGGCAACGGCAAGCCGTCGGATCTGGGTGGCAACAACCTGCCGGCCAAGTTCCTCGAGGGCTTCGTGCGGACCAGCAACATCAAGTTCCAAGACGCCTACAACGCCGGTGGCGGCCACAACGGCGTGTTCGACTTCCCGGACAGCGGTACGCACAGCTGGGAGTACTGGGGCGCGCAGCTCAACGCTATGAAGCCCGACCTGCAACGGGCACTGGGTGCCACGCCCAACACCGGGCCCGCGCCCCAGGGCGCCTA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor. It has a preference for C26:0-CoA over C18:1-CoA. {ECO:0000269|PubMed:12010501, ECO:0000269|PubMed:21819455, ECO:0000269|PubMed:3141278, ECO:0000269|PubMed:9162010}.

Family

Mycobacterial A85 antigen family

GO

diacylglycerol O-acyltransferase activity GO:0004144 molecular_function
transferase activity, transferring acyl groups other than amino-acyl groups GO:0016747 molecular_function
zymogen binding GO:0035375 molecular_function
cytoplasm GO:0005737 cellular_component
plasma membrane GO:0005886 cellular_component
extracellular region GO:0005576 cellular_component
cell wall GO:0005618 cellular_component
trehalose O-mycolyltransferase activity GO:0050348 molecular_function
mycolate cell wall layer assembly GO:0071769 biological_process
growth of symbiont in host cell GO:0044119 biological_process
growth of symbiont in host organelle GO:0044121 biological_process

InterPro

UniProt: P9WQP3
GenBank: Rv3804c
EnsemblBacteria: Rv3804c
Mycobrowser: Rv3804c

Summary

Name: Diacylglycerol acyltransferase/mycolyltransferase Ag85A (DGAT) (EC 2.3.1.122) (EC 2.3.1.20) (Acyl-CoA:diacylglycerol acyltransferase) (Antigen 85 complex A) (85A) (Ag85A) (Fibronectin-binding protein A) (Fbps A)
Family: Mycobacterial A85 antigen family
Protein Sequence: MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
Mass: 35,686 Da
Length: 338 Aa

Rv3804c doesn't seem to be a targeted by any drug.

Glycerolipid metabolism mtu00561
mtu00561
PATHWAY_MAP mtu00561 Glycerolipid metabolism

Arabinogalactan biosynthesis - Mycobacterium mtu00572
mtu00572
Metabolism; Glycan biosynthesis and metabolism

Mycobacterium tuberculosis antigen 85A and 85C structures confirm binding orientation and conserved substrate specificity.: J Biol Chem. 2004 Aug 27;279(35):36771-7. doi: 10.1074/jbc.M400811200. Epub 2004 Jun 10.
The Mycobacterium tuberculosis Ag85A is a novel diacylglycerol acyltransferase involved in lipid body formation.: Mol Microbiol. 2011 Sep;81(6):1577-92. doi: 10.1111/j.1365-2958.2011.07792.x. Epub 2011 Aug 23.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.: BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis.: Science. 1997 May 30;276(5317):1420-2. doi: 10.1126/science.276.5317.1420.
Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis.: Mol Microbiol. 2002 May;44(4):1109-22.
Evidence for three separate genes encoding the proteins of the mycobacterial antigen 85 complex.: Infect Immun. 1990 Jan;58(1):272-4.
Characterization of fibronectin-binding antigens released by Mycobacterium tuberculosis and Mycobacterium bovis BCG.: Infect Immun. 1988 Dec;56(12):3046-51.
Cloning, sequence determination, and expression of a 32-kilodalton-protein gene of Mycobacterium tuberculosis.: Infect Immun. 1989 Oct;57(10):3123-30.
Novel insights into the genetics, biochemistry, and immunocytochemistry of the 30-kilodalton major extracellular protein of Mycobacterium tuberculosis.: Infect Immun. 1996 Aug;64(8):3038-47.
Single nucleotide polymorphisms in cell wall biosynthesis-associated genes and phylogeny of Mycobacterium tuberculosis lineages.: Infect Genet Evol. 2010 May;10(4):459-66. doi: 10.1016/j.meegid.2010.03.003. Epub 2010 Mar 16.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.