whiB6
- Type
- protein_coding
- Name
- whiB6
- Locus Name
-
Rv3862c
- Product
-
Possible transcriptional regulatory protein WhiB-like WhiB6
- Functional Category
-
None
- Location
- 4338171..4338521 (- strand)
- Gene Length
- 350 bp
- Nucleotides
-
ATGCGATACGCTTTCGCGGCAGAGGCTACAACCTGCAACGCTTTCTGGAGGAACGTAGACATGACAGTAACCGCCCTGTATGAGGTCCCGCTCGGCGTTTGCACGCAAGATCCCGATCGTTGGACGACGACTCCCGACGACGAGGCCAAGACCCTGTGCCGGGCTTGCCCGCGCCGGTGGCTGTGTGCACGCGACGCCGTCGAGTCCGCGGGTGCGGAAGGGCTGTGGGCAGGGGTCGTAATTCCCGAATCAGGCCGGGCGCGGGCATTCGCGTTGGGCCAGCTGCGATCCCTGGCCGAGCGCAACGGTTACCCGGTGCGCGACCACCGGGTGTCTGCCCAATCGGCATG
- Drug Resistance
- Mutations
- Function
- Acts as a transcriptional regulator. Probably redox-responsive. The apo- but not holo-form probably binds DNA (By similarity). The apo-form has been shown to act as a protein disulfide reductase. {ECO:0000250, ECO:0000269|PubMed:19016840}.
- Family
-
WhiB family
- GO
-
- metal ion binding GO:0046872 molecular_function
- DNA binding GO:0003677 molecular_function
- regulation of transcription, DNA-templated GO:0006355 biological_process
- cytoplasm GO:0005737 cellular_component
- 4 iron, 4 sulfur cluster binding GO:0051539 molecular_function
- dinitrosyl-iron complex binding GO:0035731 molecular_function
- InterPro
Summary
- Name
- Probable transcriptional regulator WhiB6
- Family
- WhiB family
- Protein Sequence
-
MRYAFAAEATTCNAFWRNVDMTVTALYEVPLGVCTQDPDRWTTTPDDEAKTLCRACPRRWLCARDAVESAGAEGLWAGVVIPESGRARAFALGQLRSLAERNGYPVRDHRVSAQSA
- Mass
- 12,792 Da
- Length
- 116 Aa
Rv3862c doesn't seem to be a targeted by any drug.
Rv3862c doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis WhiB4 regulates oxidative stress response to modulate survival and dissemination in vivo.
- Mol Microbiol. 2012 Sep;85(6):1148-65. doi: 10.1111/j.1365-2958.2012.08165.x. Epub 2012 Jul 26.
- Studies on structural and functional divergence among seven WhiB proteins of Mycobacterium tuberculosis H37Rv.
- FEBS J. 2009 Jan;276(1):76-93. doi: 10.1111/j.1742-4658.2008.06755.x.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.