sigM
- Type
- protein_coding
- Name
- sigM
- Locus Name
-
Rv3911
- Product
-
Possible alternative RNA polymerase sigma factor SigM
- Functional Category
-
None
- Location
- 4400186..4400854 (+ strand)
- Gene Length
- 668 bp
- Nucleotides
-
TGCCGCCACCGATTGGTTACTGTCCGGCCGTGGGTTTCGGGGGCCGTCACGAGCGCAGCGACGCCGAGCTGCTGGCCGCCCATGTCGCCGGCGACCGGTACGCCTTCGATCAGTTGTTCCGCCGTCATCACCGCCAGCTACACCGGCTCGCGCGGCTCACCAGCCGGACCTCCGAGGACGCCGACGATGCGCTGCAAGACGCGATGCTGTCAGCGCACCGCGGCGCCGGCTCGTTCCGGTACGATGCCGCCGTCAGCAGTTGGTTGCACCGCATCGTGGTCAACGCTTGCCTGGACCGGCTGCGTCGGGCCAAAGCCCATCCGACCGCCCCTCTAGAAGATGTCTATCCGGTCGCGGACCGGACCGCGCAGGTCGAGACCGCGATCGCGGTGCAGCGGGCACTGATGCGGCTGCCCGTCGAGCAGCGGGCCGCGGTGGTCGCCGTGGACATGCAGGGCTATTCGATCGCCGACACCCGCCCGGATGCTGGGCGTGGCCGAGGGCACCGTCAAGAGCCGCTGCGCCCGGGCGCGGGCCCGCCTAGCGCGGCTGCTGGGCTATCTCAACACCGGGGTGAACATCCGGCGCTGACCCCGTTGCCGGTCCGTCGTAGCATCGATCCACGGGCTCGCCGCTACCCCACATCTGGCTATTGCCACCGGGCATGA
- Drug Resistance
- Mutations
- Function
- Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor (RsaM, AC L7N5D7) until released by regulated intramembrane proteolysis (Probable). This sigma factor is required for the synthesis of surface or secreted molecules. {ECO:0000269|PubMed:17028284, ECO:0000305}.
- Family
-
Sigma-70 factor family, ECF subfamily
- GO
-
- sigma factor activity GO:0016987 molecular_function
- plasma membrane GO:0005886 cellular_component
- DNA-templated transcription, initiation GO:0006352 biological_process
- positive regulation of transcription, DNA-templated GO:0045893 biological_process
- DNA binding GO:0003677 molecular_function
- DNA-binding transcription factor activity GO:0003700 molecular_function
- response to xenobiotic stimulus GO:0009410 biological_process
- response to water GO:0009415 biological_process
- InterPro
Summary
- Name
- ECF RNA polymerase sigma factor SigM (ECF sigma factor SigM) (Alternative RNA polymerase sigma factor SigM) (RNA polymerase sigma-M factor) (Sigma-M factor)
- Family
- Sigma-70 factor family, ECF subfamily
- Protein Sequence
-
MPPPIGYCPAVGFGGRHERSDAELLAAHVAGDRYAFDQLFRRHHRQLHRLARLTSRTSEDADDALQDAMLSAHRGAGSFRYDAAVSSWLHRIVVNACLDRLRRAKAHPTAPLEDVYPVADRTAQVETAIAVQRALMRLPVEQRAAVVAVDMQGYSIADTARMLGVAEGTVKSRCARARARLARLLGYLNTGVNIRR
- Mass
- 21,649 Da
- Length
- 196 Aa
Rv3911 doesn't seem to be a targeted by any drug.
Rv3911 doesn't seem to be involved in any pathway.
- WhiB5, a transcriptional regulator that contributes to Mycobacterium tuberculosis virulence and reactivation.
- Infect Immun. 2012 Sep;80(9):3132-44. doi: 10.1128/IAI.06328-11. Epub 2012 Jun 25.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis.
- Mol Microbiol. 1999 Jan;31(2):715-24.
- Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis.
- J Bacteriol. 2006 Dec;188(24):8460-8. doi: 10.1128/JB.01212-06. Epub 2006 Oct 6.
- Examination of Mycobacterium tuberculosis sigma factor mutants using low-dose aerosol infection of guinea pigs suggests a role for SigC in pathogenesis.
- Microbiology. 2006 Jun;152(Pt 6):1591-600. doi: 10.1099/mic.0.28591-0.