rnpA
- Type
- protein_coding
- Name
- rnpA
- Locus Name
-
Rv3923c
- Product
-
Ribonuclease P protein component RnpA (RNaseP protein) (RNase P protein) (protein C5)
- Functional Category
-
None
- Location
- 4410412..4410789 (- strand)
- Gene Length
- 377 bp
- Nucleotides
-
TTGATTGCAACACCGGGCTTATTTGCGGTGCTTCGTGCACGCAACCGCATGAGGCGGTCAGCGGATTTTGAAACAACGGTGAAGCACGGGATGCGTACCGTGCGGTCTGACATGGTCGTTTATTGGTGGCGTGGGAGTGGCGGTGGGCCGCGCGTCGGACTGATTATCGCCAAGTCGGTGGGGTCGGCCGTGGAACGCCACCGCGTGGCACGTCGGCTGCGGCACGTGGCTGGGTCGATCGTCAAAGAACTCCACCCGTCCGATCATGTGGTGATCCGCGCGCTGCCGAGCAGCCGGCATGTCTCCTCGGCTCGGTTGGAGCAGCAACTGCGATGCGGCTTGCGGAGGGCTGTCGAACTGGCAGGTAGTGATCGGTG
- Drug Resistance
- Mutations
- Function
- RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme. {ECO:0000255|HAMAP-Rule:MF_00227}.
- Family
-
RnpA family
- GO
-
- ribonuclease P activity GO:0004526 molecular_function
- tRNA binding GO:0000049 molecular_function
- tRNA 5'-leader removal GO:0001682 biological_process
- 3'-tRNA processing endoribonuclease activity GO:0042781 molecular_function
- ribonuclease P complex GO:0030677 cellular_component
- tRNA 3'-trailer cleavage, endonucleolytic GO:0034414 biological_process
- InterPro
Summary
- Name
- Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5)
- Family
- RnpA family
- Protein Sequence
-
MLRARNRMRRSADFETTVKHGMRTVRSDMVVYWWRGSGGGPRVGLIIAKSVGSAVERHRVARRLRHVAGSIVKELHPSDHVVIRALPSSRHVSSARLEQQLRCGLRRAVELAGSDR
- Mass
- 13,072 Da
- Length
- 116 Aa
Rv3923c doesn't seem to be a targeted by any drug.
Rv3923c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Organization of the origins of replication of the chromosomes of Mycobacterium smegmatis, Mycobacterium leprae and Mycobacterium tuberculosis and isolation of a functional origin from M. smegmatis.
- Mol Microbiol. 1996 Apr;20(2):283-93.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.